1395706

Question: If you blast BAC82414.1 and CAA82265.1 what is the identity of
the first mismatch in the query in…


If you blast BAC82414.1 and CAA82265.1 what is the identity of
the first mismatch in the query in this alignment?
Tyrosine
Tryptophan
Phenylalanine
Methionine
ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Acetabularia peniculus Sequence ID: CAA82265.1 See 1 more title(s) Range 1: 57 to 87 GenPept Graphics Score 35.8 bits(81) 4e-09 Composition-based stats. ▼Next Match ▲ Previous Mat Positives 21/31(67%) Gaps 0/31(096) Expect Method Identities 14/31(4596) Query 7 TFSFLSDLTKEQIDKQIKYAISKKWSIGIEY 37 sbjct 57 TFSYLPPLTDEQISKQVDYILANSWTPCLEF 87

Show transcribed image text

ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Acetabularia peniculus Sequence ID: CAA82265.1 See 1 more title(s) Range 1: 57 to 87 GenPept Graphics Score 35.8 bits(81) 4e-09 Composition-based stats. ▼Next Match ▲ Previous Mat Positives 21/31(67%) Gaps 0/31(096) Expect Method Identities 14/31(4596) Query 7 TFSFLSDLTKEQIDKQIKYAISKKWSIGIEY 37 sbjct 57 TFSYLPPLTDEQISKQVDYILANSWTPCLEF 87

(Visited 1 times, 1 visits today)